PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10025818m
Common NameEUTSA_v10025818mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family NAC
Protein Properties Length: 306aa    MW: 33839.7 Da    PI: 8.4132
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10025818mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.32.5e-52141391128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrF Ptdeel+v+yL++kv+g +++l +vi ++d+yk++PwdLp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk +++
  Thhalv10025818m  14 LPPGFRFYPTDEELLVQYLCRKVAGYHFSL-QVIGDIDLYKFDPWDLPSKALFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITA 106
                      79***************************9.99***************8777899***********************************9999 PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +g+ vg+kk Lvfy g+apkg+kt+W+mheyrl
  Thhalv10025818m 107 -DGHRVGIKKALVFYAGKAPKGTKTNWIMHEYRL 139
                      .999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.37E-679162IPR003441NAC domain
PROSITE profilePS5100560.73714162IPR003441NAC domain
PfamPF023655.9E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MGVREKDPLA QLSLPPGFRF YPTDEELLVQ YLCRKVAGYH FSLQVIGDID LYKFDPWDLP  60
SKALFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIITADGHR VGIKKALVFY  120
AGKAPKGTKT NWIMHEYRLI EHSRSHGSSK LDDWVLCRIY KKTSGAQRQA APVQPCAEEQ  180
SMNGSSSSSS SQLDDVLDSF PEMNDRSFNL PRINSLRTLL NGNFDWASLA SLHSIPELAP  240
TNGNYGGYDA FRAAEGEAES GLRNSQVVDQ QQNSSGSGLT QSFGYSSSGL NRGFGISGQT  300
FGFSQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-10811687174NAC domain-containing protein 19
3swm_B1e-10811687174NAC domain-containing protein 19
3swm_C1e-10811687174NAC domain-containing protein 19
3swm_D1e-10811687174NAC domain-containing protein 19
3swp_A1e-10811687174NAC domain-containing protein 19
3swp_B1e-10811687174NAC domain-containing protein 19
3swp_C1e-10811687174NAC domain-containing protein 19
3swp_D1e-10811687174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3525350.0AK352535.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-04-F07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006413079.10.0hypothetical protein EUTSA_v10025818mg
SwissprotQ93VY30.0NAC72_ARATH; NAC domain-containing protein 72
TrEMBLE4MVI80.0E4MVI8_EUTHA; mRNA, clone: RTFL01-04-F07
TrEMBLV4MGY90.0V4MGY9_EUTSA; Uncharacterized protein
STRINGBra019052.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14352795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.20.0NAC family protein